PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BS_59D534318.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 772aa    MW: 88086 Da    PI: 7.7137
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BS_59D534318.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA43.25.6e-14105141135
                   GATA   1 CsnCgttk..TplWRrgpdgnktLCnaCGlyyrkkgl 35 
                            C  Cg +   Tp++Rrgpdg++tLCnaCG+ yrk ++
  Traes_2BS_59D534318.1 105 CLRCGISGnaTPHMRRGPDGPRTLCNACGIAYRKGKM 141
                            5667777777************************876 PP

2FAR183.63.3e-26175262191
                   FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                            +fYn+YA +vGFsvrks+s+ks++n  ++ rtfvCs+eg+++++k+   +++++r  tr+gC a+l +k + + k++vt+++ eHnH+
  Traes_2BS_59D534318.1 175 EFYNKYAGHVGFSVRKSTSHKSSENI-TKVRTFVCSREGYNRDKKSL--EAKKPRLDTRIGCPARLIIKVTPECKYRVTDFKAEHNHQ 259
                            6*********************6666.899*************9988..99************************************* PP

                   FAR1  89 lap 91 
                            lap
  Traes_2BS_59D534318.1 260 LAP 262
                            986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577162.33E-10100151No hitNo description
SMARTSM004016.5E-6101154IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.2E-11104143IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.03E-7104142No hitNo description
PfamPF003201.4E-11105140IPR000679Zinc finger, GATA-type
PfamPF031011.8E-23175262IPR004330FAR1 DNA binding domain
PfamPF105512.2E-26385479IPR018289MULE transposase domain
PfamPF044347.9E-7661699IPR007527Zinc finger, SWIM-type
PROSITE profilePS509669.977664700IPR007527Zinc finger, SWIM-type
SMARTSM005755.4E-6675702IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 772 aa     Download sequence    Send to blast
MRPHEATYRA AASDPSTPSP IPTPLICYPS SDSHKPRGFP KFVRNFLPNH SPVLPKGGDA  60
MMHMLVASDG GGGEMHPYAA VPAEQELELH RDNAADDSLD GHVRCLRCGI SGNATPHMRR  120
GPDGPRTLCN ACGIAYRKGK MRRMIEAEPP IDEASLAKLV PEVDMEFESE EKAYEFYNKY  180
AGHVGFSVRK STSHKSSENI TKVRTFVCSR EGYNRDKKSL EAKKPRLDTR IGCPARLIIK  240
VTPECKYRVT DFKAEHNHQL APPSTMHMLR SQRILTELQS GEAELSDDSV VTPTTKATGD  300
LVVRQVGFLR SISVLPADYN NYLRSKRTKA MQPGDGGAIL KYLQTMQMDN PSFFYTMQID  360
EDDKLTNFFW ADPKSREDFT YFNDVLCLDT TYKINGYGRP LALFLGVNHH RQTIIFGAAM  420
LYDESFESYK WLFESFKIAM HGKEPAVALI DQSIQLSSAM AAAWPNTAQR VCAWHVYQNS  480
VKHLNQVFQG SKTFAKDFSK CVFGYEEEEE FVFAWRTMLE KYDLRHNEWL SKLFDERERW  540
ALAYDRHIFC ADIISSLQAE SFSSILKKFL SPQLDLLSFF KHYERAVDEH RYAELQADFQ  600
ASQSYPRIPP AKMLKQTSHT YTPVVFEIFR KEFELFMDSV LFTCGEAGTT SDYKVAPSEK  660
PKEHFVRFNS SDNSCMCTCK KFEFMGIPCC HMLKVLDYRN IKELPHIYLL KRWRRTAKST  720
DEDSQGHAAN DNRSSLNVSV PSANHHGLQS INARIQDTSL SNMHENPFHR SS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3583410.0AK358341.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1074F13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235320.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_010235328.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLW5BKD50.0W5BKD5_WHEAT; Uncharacterized protein
STRINGMLOC_70827.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP1832967
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-117FAR1-related sequence 5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]